HORDB

ID: hor004157
Uniprot ID: Q1RMJ9
Protein name: Urocortin-3
Gene name: UCN3
Organism: Bos taurus (Bovine)
Family: Sauvagine/corticotropin-releasing factor/urotensin I family
Source: animal
Expression: hypothalamus and placenta
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051429 corticotropin-releasing hormone receptor binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
GO BP: GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007586 digestion; GO:0009755 hormone-mediated signaling pathway; GO:0031669 cellular response to nutrient levels
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: VTLSLDVPTNIMNILFNIAKAKNLRAKAAANAHLMAQI
Length: 38
Propeptide: MLVPAPFLLVLLLLLGAPQVGLSQRSPKAGSSPSCLHTALREAEKSQRKDTSLLIKRTFPALPRGDPEDQEGQEEEDTEKRTFPGSVGGGGGGGAGSTRYKYPSQAQFQGRPSQDKAKSDRRTKVTLSLDVPTNIMNILFNIAKAKNLRAKAAANAHLMAQIGRKK
Signal peptide: MLVPAPFLLVLLLLLGAPQVGLS
Modification: T38 Isoleucine amide
Glycosylation: NA
Mutagenesis: NA

Function: Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress
Mechanism: NA
Cross BBB: YES
Target: CRHR2, CRH
Target Unid: F1MFI6, Q95MI6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004157_AF2.pdb

hor004157_ESM.pdb

Mass:	475110	Formula:	C182H310N52O50S2
Absent amino acids:	CEGWY	Common amino acids:	A
pI:	11.08	Basic residues:	5
Polar residues:	8	Hydrophobic residues:	20
Hydrophobicity:	49.21	Boman Index:	-1771
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	128.68
Instability Index:	5445.53	Extinction Coefficient cystines:	0
Absorbance 280nm:	0